Invitrogen™ Human ITFG3 (aa 234-320) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108590	100 μL

Catalog No. RP108590 Supplier Invitrogen™ Supplier No. RP108590

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84880. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ITFG3 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include cell surface; extracellular exosome; integral component of membrane.

Specifications

• Accession Number: Q9H0X4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 83986
• Name: Human ITFG3 (aa 234-320) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C16orf9; Fam234a; family with sequence similarity 234 member A; family with sequence similarity 234, member A; gs19; integrin alpha FG-GAP repeat containing 3; ITFG3; Protein FAM234A; protein ITFG3; RGD1311484
• Common Name: ITFG3
• Gene Symbol: FAM234A
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: REEVSGHLYSGSTGHQIGLRGSLGVDGESGFLLHVTRTGAHYILFPCASSLCGCSVKGLYEKVTGSGGPFKSDPHWESMLNATTRRM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining