Invitrogen™ Human JAB1 (aa 16-148) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102506	100 μL

Catalog No. RP102506 Supplier Invitrogen™ Supplier No. RP102506

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82170. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

JAB-1 is a 38 kDa protein which was originally described as a coactivator for cJUN. It is present in a large protein complex called the 'Signalosome', which has been proposed to play a signaling role in mammalian cells. This protein complex appears to be analogous to the COP9 complex in plants, which is important in light-mediated plant development. Although the specific function of JAB-1 in this complex is unclear, it has recently been implicated in targeting proteins for degradation by the proteasome.

Specifications

• Accession Number: Q92905
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10987
• Name: Human JAB1 (aa 16-148) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 38 kDa Mov34 homolog; AI303502; COP9 (constitutive photomorphogenic) homolog, subunit 5; COP9 (constitutive photomorphogenic) homolog, subunit 5 (Arabidopsis thaliana); COP9 complex S5; COP9 constitutive photomorphogenic homolog subunit 5; COP9 signalosome complex subunit 5; COP9 signalosome subunit 5; Cops5; CSN5; JAB1; Jun activation domain-binding protein 1; Jun coactivator; Kic2; Kip1 C-terminus-interacting protein 2; MGC3149; Mov34; MOV-34; SGN5; signalosome subunit 5; testis secretory sperm-binding protein Li 231m
• Common Name: JAB1
• Gene Symbol: Cops5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining