Invitrogen™ Human JAK3 (aa 252-335) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104037	100 μL

Catalog No. RP104037 Supplier Invitrogen™ Supplier No. RP104037

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84838. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Janus kinase 3 (JAK3) phosphorylates members of the STAT (signal transduction and activators of transcription) family. JAK3 is predominantly expressed in immune cells and transduces a signal in response to activation of interleukin receptors. In response to a varitety of cytokine or related factors (e.g., interferon, interleukins), JAKs are activated via phosphorylation at 2 adjacent tyrosine residues. The activation of JAKs can lead to the phosphorylation of STAT (signal transducers and activatiors of transcription) proteins, which dimerize and translocate to the nucleus. Once translocated to the nucleus, the STAT proteins can modify transcription of numerous genes, including interferon-stimulated genes. JAK2 is required for the IFN gamma-receptor complex initiation and JAK1 functions as an amplifier. However, active JAK1 may be required for complex responses. Some studies have suggested that the role of JAK2 might be performed by Tyk2 and JAK3, if they were positioned correctly within the IFN gamma-receptor complex.

Specifications

• Accession Number: P52333
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3718
• Name: Human JAK3 (aa 252-335) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Breast-JAK3; fae; JAK3; JAK-3; JAK3_HUMAN; JAK3B; JAKL; Janus kinase 3; Janus kinase 3 (a protein tyrosine kinase, leukocyte); Janus kinase 3 protein-tyrosine kinase; Janus kinase 3, protein-tyrosine kinase; L JAK; Leukocyte janus kinase; LJAK; L-JAK; RATJAK3; Tyrosine-protein kinase JAK3; wil
• Common Name: JAK3
• Gene Symbol: JAK3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVDISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining