Invitrogen™ Human JAKMIP1 (aa 332-414) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96694	100 μL

Catalog No. RP96694 Supplier Invitrogen™ Supplier No. RP96694

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60756. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

JAKMIP1, also known as Marlin-1, is a highly-conserved vertebrate-specific microtubule-associated protein that plays a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements. JAKMIP1 is expressed predominantly in neuronal and lymphoid cells and colocalizes with microtubules. Multiple isoforms of JAKMIP1 are known to exist: isoforms 1 and 5 are also expressed in liver, lung and skeletal muscle, while isoforms 2-4 are specifically expressed in brain and retina. JAKMIP1 participates in polarized secretion in lymphocytes and it has been suggested to be a novel effector memory gene restraining T cell-mediated cytotoxicity. Dysregulation of JAKMIP1 gene expression is associated with genetic conditions linked to autism in humans.

Specifications

• Accession Number: Q96N16
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 152789
• Name: Human JAKMIP1 (aa 332-414) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5830437M04Rik; C330021K24Rik; FLJ31564; GABA-B receptor-binding protein; Gababrbp; gamma-aminobutyric acid (GABA-B) receptor binding protein; Jak and microtubule interacting protein 1; Jakmip1; JAMIP1; janus kinase and microtubule interacting protein 1; janus kinase and microtubule-interacting protein 1; MARLIN1; Marlin-1; Multiple alpha helices and RNA-linker protein 1; multiple alpha-helices and RNA-linker protein 1; multiple coiled-coil GABABR1-binding protein
• Common Name: JAKMIP1
• Gene Symbol: JAKMIP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVEKNKRMNKKNEDLLQSIQRMEEKIKNLTRENVEMKEKLSAQASLKRHTSLNDLSLTRDEQEIEFLRLQVLEQQHVIDDLSL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining