Invitrogen™ Human JARID2 (aa 967-1050) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107294	100 μL

Catalog No. RP107294 Supplier Invitrogen™ Supplier No. RP107294

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Jumonji (JARID2) is a nuclear protein that participates in the negative regulation of cell growth. It is required for neural tube formation and is essential for normal heart development and function. Also, it is a part of a group of proteins characterized by a novel structural motif, the JmjC domain, which is implicated in chromatin regulation through histone demethylation.

Specifications

• Accession Number: Q92833
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3720
• Name: Human JARID2 (aa 967-1050) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: JARD2 antibody; Jarid2; Jmj; jumonji; jumonji and AT-rich interaction domain containing 2; jumonji homolog; jumonji, AT rich interactive domain 2; jumonji, AT rich interactive domain 2 protein; jumonji/ARID domain-containing protein 2; jumonji-like protein; LOW QUALITY PROTEIN: protein Jumonji; protein Jumonji
• Common Name: JARID2
• Gene Symbol: JARID2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLQANGTPGLQMLESNVMISPEVLCKEGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYSVSETVHFATTQWTSMGFETAKEMKRR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining