Invitrogen™ Human JMJD2C (aa 996-1054) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107688	100 μL

Catalog No. RP107688 Supplier Invitrogen™ Supplier No. RP107688

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67044. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Jumonji domain-containing protein 2C (JMJD2C)/ Lysine-specific demethylase 4C (KDM4C) is a histone demethylase that specifically demethylates 'Lys-9' and 'Lys-36' residues of histone H3; thereby, playing a central role in histone code. KDM4C does not demethylate histone H3 'Lys-4', H3 'Lys-27', or H4 'Lys-20'. It demethylates trimethylated H3 'Lys-9' and H3 'Lys-36' residues. There is no activity on mono- or dimethylated residues. Demethylation of Lys residues generates formaldehyde and succinate.

Specifications

• Accession Number: Q9H3R0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 23081
• Name: Human JMJD2C (aa 996-1054) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2410141F18Rik; AA517467; bA146B14.1; GASC1; GASC-1 protein; gene amplified in squamous cell carcinoma 1; gene amplified in squamous cell carcinoma 1 protein; JHDM3C; JmjC domain-containing histone demethylation protein 3C; JMJD2C; jumonji domain containing 2C; jumonji domain-containing protein 2C; Kdm4c; KIAA0780; lysine (K)-specific demethylase 4C; lysine demethylase 4C; lysine-specific demethylase 4C; RP11-169L18.1; TDRD14C; tudor domain containing 14C
• Common Name: JMJD2C
• Gene Symbol: KDM4C
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining