Invitrogen™ Human KANK3 (aa 396-450) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99982	100 μL

Catalog No. RP99982 Supplier Invitrogen™ Supplier No. RP99982

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62333. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ankyrins are membrane adaptor molecules that play important roles in the control of cytoskeleton formation by regulating actin polymerization. Like other members of the KANK family, KANK3 (KN motif and ankyrin repeat domain-containing protein 3), is thought to play a role in the formation of actin stress fibers. In zebrafish, the homolog of KANK3 interacts with the adaptor protein Numb, a protein implicated in multiple basic cellular processes, and is essential for epidermal integrity and neurulation, suggesting that KANK3 may play a similar role in higher organisms.

Specifications

• Accession Number: Q6NY19
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 256949
• Name: Human KANK3 (aa 396-450) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0610013D04Rik; Ankrd47; ankyrin repeat domain 47; ankyrin repeat domain-containing protein 47; D17Ertd288e; Kank3; kidney ankyrin repeat-containing protein 3; KN motif and ankyrin repeat domain-containing protein 3; KN motif and ankyrin repeat domains 3; NG28; putative KN motif and ankyrin repeat domains 3
• Common Name: KANK3
• Gene Symbol: KANK3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLREATTQTPWSCAEKAAQTESPAEAPSLTQESSPGSMDGDRAVAPAGILKSIMK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining