Invitrogen™ Human KATNA1 (aa 135-210) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95028	100 μL

Catalog No. RP95028 Supplier Invitrogen™ Supplier No. RP95028

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57571. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemble microtubules, while the p80 subunit targets the enzyme to the centrosome. This gene encodes the p80 subunit. This protein is a member of the AAA family of ATPases.

Specifications

• Accession Number: O75449
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 11104
• Name: Human KATNA1 (aa 135-210) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: HAMAP-Rule:MF_03023}; hypothetical protein LOC553631; katanin catalytic subunit A1; katanin p60 (ATPase containing) subunit A 1; katanin p60 (ATPase-containing) subunit A 1; katanin p60 (ATPase-containing) subunit A1; katanin p60 ATPase-containing subunit A1; katanin p60 ATPase-containing subunit A1 {ECO:0000255; Katanin p60 ATPase-containing subunit A1-like protein; katanin p60 subunit A 1; katanin p60 subunit A1; katanin p60 subunit A1 {ECO:0000255; KATNA1; lipotransin; microtubule severing protein; p60 katanin; p60 katanin {ECO:0000255; si:dkey-15j16.1; zgc:110580
• Common Name: KATNA1
• Gene Symbol: KATNA1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RVHRSSAQNVHNDRGKAVRCREKKEQNKGREEKNKSPAAVTEPETNKFDSTGYDKDLVEALERDIISQNPNVRWDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining