Invitrogen™ Human KCNK5 (aa 342-414) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101835	100 μL

Catalog No. RP101835 Supplier Invitrogen™ Supplier No. RP101835

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63672. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KCNK5 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK5 is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport.

Specifications

• Accession Number: O95279
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 8645
• Name: Human KCNK5 (aa 342-414) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Acid-sensitive potassium channel protein TASK-2; K2p5.1; K2P5.1 potassium channel; Kcnk5; KCNK5b; Potassium channel subfamily K member 5; potassium channel, subfamily K, member 1 (TASK-2); potassium channel, subfamily K, member 5; potassium channel, subfamily, member 5 (KCNK5); potassium channel, two pore domain subfamily K, member 5; potassium inwardly-rectifying channel, subfamily K, member 5; potassium two pore domain channel subfamily K member 5; TASK2; TASK-2; TWIK-related acid-sensitive K(+) channel 2; TWIK-related acid-sensitive K+ channel 2; two-pore potassium channel
• Common Name: KCNK5
• Gene Symbol: KCNK5
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VPLVVYSKNRVPTLEEVSQTLRSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining