Invitrogen™ Human KCNN4 (aa 301-360) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101652	100 μL

Catalog No. RP101652 Supplier Invitrogen™ Supplier No. RP101652

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization, which promotes calcium influx. The encoded protein may be part of the predominant calcium-activated potassium channel in T-lymphocytes. This gene is similar to other KCNN family potassium channel genes, but it differs enough to possibly be considered as part of a new subfamily.

Specifications

• Accession Number: O15554
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3783
• Name: Human KCNN4 (aa 301-360) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: DHS2; HIK1; hIKCa1; hKCa4; hSK4; IK; IK1; IKCa; IKCA1; intermediate conductance calcium-activated potassium channel protein 1; intermediate conductance calcium-activated potassium channel protein 4; intermediate conductance K channel; intermediate-conductance Ca-activated K channel; intermediate-conductance calcium-activated potassium channel; KCa3.1; KCA4; KCNN 4; KCNN4; mIKCa1; potassium calcium-activated channel subfamily N member 4; potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 4; potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4; putative erythrocyte intermediate conductance calcium-activated potassium Gardos channel; putative Gardos channel; rKCNN4c; rSK4; SK4; SKCa 4; SKCa4; SKCas; small conductance calcium-activated potassium channel 4
• Common Name: KCNN4
• Gene Symbol: Kcnn4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining