Invitrogen™ Human KCNQ1 (aa 545-604) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP110230	100 μL

Catalog No. RP110230 Supplier Invitrogen™ Supplier No. RP110230

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144998. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated K+ channels in the plasma membrane control the repolarization and the frequency of action potentials in neurons, muscles and other excitable cells. A specific K+ channel, comprised of an alpha subunit KCNQ1 and a beta subunit KCNE1, a small protein which spans the membrane only once, is predominantly expressed in the heart and in the cochlea, and is responsible for regulating the slow, depolarization-activated potassium current. Mutations in the genes encoding for KCNQ1 and KCNE1 lead to cardiac disease because they directly impair electrical signaling, and mutations in KCNQ4 are implicated in the onset of deafness. KCNQ proteins, including KCNQ1 and KCNQ4, characteristically contain six transmembrane domains and function as tetramers. KCNQ4 forms heteromeric channels with KCNQ3 and is expressed in several tissues, including the cochlea, where it is present in outer hair cells.

Specifications

• Accession Number: P51787
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3784
• Name: Human KCNQ1 (aa 545-604) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ATFB1; ATFB3; AW559127; FLJ26167; IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1; JLNS1; KCNA8; KCNA9; Kcnq1; kidney and cardiac voltage dependend K+ channel; KQT-like 1; Kv1.9; Kv7.1; KVLQT1; LQT; LQT1; mutant potassium voltage-gated channel KQT-like subfamily member 1; potassium channel, voltage gated KQT-like subfamily Q, member 1; potassium channel, voltage-gated KQT-like subfamily Q, member 1; potassium voltage-gated channel subfamily KQT member 1; potassium voltage-gated channel subfamily Q member 1; potassium voltage-gated channel, KQT-like subfamily, member 1; potassium voltage-gated channel, subfamily Q, member 1; RWS; slow delayed rectifier channel subunit; SQT2; voltage-gated potassium channel subunit Kv7.1; WRS
• Common Name: KCNQ1
• Gene Symbol: KCNQ1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YSQGHLNLMVRIKELQRRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVTQLDQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining