Invitrogen™ Human KCNQ2 (aa 622-696) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103292	100 μL

Catalog No. RP103292 Supplier Invitrogen™ Supplier No. RP103292

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KCNQs are members of the voltage-dependent non-inactivating potassium channel family. Currently there are five known KNCQs (KCNQ1-5) found in the central nervous system and KNCQ2 and 3 have demonstrated their importance in M-current activation. Studies have shown that KCNQ2 and KCNQ3 form heteromultimers that, when formed, substantially increase the M-current. Inhibition of M-current controls neuron excitability throughout the nervous system as well as the responsiveness to synaptic inputs. Genetic mutations in these proteins have been linked to disorders such as benign familial neonatal convulsions (BFNC), deafness, neuropathic pain and epilepsy.

Specifications

• Accession Number: O43526
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3785
• Name: Human KCNQ2 (aa 622-696) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BFNC; EBN; EBN1; ENB1; HNSPC; KCNA11; KCNQ2; KQT like 2; KQT2; KQT-like 2; KV7.2; KVEBN1; mKQT2.3; mKQT2.4; neuroblastoma-specific potassium channel subunit alpha KvLQT2; Nmf134; potassium channel subunit alpha KvLQT2; potassium channel, voltage gated KQT-like subfamily Q, member 2; potassium channel, voltage-gated KQT-like subfamily Q, member 2; potassium voltage-gated channel KQT-like subfamily member 2.3; potassium voltage-gated channel KQT-like subfamily member 2.4; potassium voltage-gated channel subfamily KQT member 2; potassium voltage-gated channel subfamily Q member 2; potassium voltage-gated channel, KQT-like subfamily, member 2; potassium voltage-gated channel, subfamily Q, member 2; voltage-gated potassium channel subunit Kv7.2
• Common Name: KCNQ2
• Gene Symbol: KCNQ2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RLGKVEKQVLSMEKKLDFLVNIYMQRMGIPPTETEAYFGAKEPEPAPPYHSPEDSREHVDRHGCIVKIVRSSSST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining