Invitrogen™ Human KHDC1 (aa 54-114) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94834	100 μL

Catalog No. RP94834 Supplier Invitrogen™ Supplier No. RP94834

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56041. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KHDC1 family members are K-homology (KH) domain-containing RNA binding proteins that are involved in various aspects of RNA metabolism, ranging from transcription to RNA splicing, transportation, translation, and stability. KHDC1 is highly expressed in oocytes and interacts with cytoplasmic polyadenylation element-binding protein 1 (CPEB1), a key translational regulator controlling the polyA length of mRNAs. KHDC1 functions as a global translational repressor and induces apoptosis through an ER-dependent signaling pathway and that the C-terminal putative trans-membrane motif (TMM) is critical for its activities.

Specifications

• Accession Number: Q4VXA5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 80759
• Name: Human KHDC1 (aa 54-114) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AU014713; bA257K9.4; C6orf147; C6orf148; C88118; Em:AC019205.8; KH domain containing 1A; KH domain containing 1C; KH homology domain containing 1; KH homology domain containing 1A; KH homology domain-containing protein 1; KH homology domain-containing protein 1A; KHDC1; Khdc1a; Khdc1c; MGC10818; Ndg1; nur77 downstream gene 1 protein; Nur77 downstream protein 1
• Common Name: KHDC1
• Gene Symbol: KHDC1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RERNSRSGKTRCRSKRSEQSMDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining