Invitrogen™ Human KIAA1324L (aa 711-793) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108070	100 μL

Catalog No. RP108070 Supplier Invitrogen™ Supplier No. RP108070

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67405. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KIAA1324L is a protein coding gene.

Specifications

• Accession Number: A8MWY0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 222223
• Name: Human KIAA1324L (aa 711-793) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9330182L06Rik; EIG121L; EIG121-like; Estrogen-induced gene 121-like protein; h EIG121-like; hEIG121L; KIAA1324 like; KIAA1324L; KIAA1324-like; RIKEN cDNA 9330182L06 gene; UPF0577 protein KIAA1324-like; UPF0577 protein KIAA1324-like homolog
• Common Name: KIAA1324L
• Gene Symbol: KIAA1324L
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YFHFFNISLCGHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSIILADTFIGVTVETT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining