Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human KIF1C Control Fragment Recombinant Protein

Catalog No. RP100039
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP100039 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP100039 Supplier Invitrogen™ Supplier No. RP100039
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60899. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The kinesins constitute a large family of microtubule-dependent motor proteins, which are responsible for the distribution of numerous organelles, vesicles and macromolecular complexes throughout the cell. Individual kinesin members play crucial roles in cell division, intracellular transport, and membrane trafficking events including endocytosis and transcytosis. KIF1C is a member of the KIF1/Unc104 family of kinesin-like proteins, which are involved in the transport of mitochondria or synaptic vesicles in axons. Human KIF1C maps to chromosome 17p13 and encodes a predicted 1,103 amino acid protein with abundant expression in heart and skeletal muscle. Tyrosine phosphorylation is a putative regulator of KIF1C mediated retrograde transport of Golgi vesicles to the endoplasmic reticulum. KIF1C is capable of forming homodimers and can noncovalently associate with 14-3-3 beta, gamma, epsilon and zeta. In mouse macrophages, KIF1C is required for anthrax lethal toxin resistance.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43896
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 10749
Name Human KIF1C Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias B430105J22Rik; D11Bwg1349e; KIAA0706; Kif1c; Kif1d; kinesin 1C; kinesin family member 1C; kinesin superfamily protein 1C; kinesin-like protein KIF1C; Kinesin-like protein KIF1D; lethal factor toxin susceptibility 1; Ltxs1; N-3 kinsin; SATX2; SAX2; spastic ataxia 2 (autosomal recessive); SPAX2; SPG58
Common Name KIF1C
Gene Symbol KIF1C
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QAHICKLMGILQQVKLQNSSKDWELQALQDRMVCMERIIPLAQDHEDENEEGGEFHWA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.