Invitrogen™ Human KIFC2 (aa 200-296) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP93887	100 μL

Catalog No. RP93887 Supplier Invitrogen™ Supplier No. RP93887

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56098. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Kinesins are a superfamily of microtubule-associated motor proteins involved in a variety of cellular processes including membranous organelle transport and cell division. Kinesin has been found in a variety of organisms and cell types and is subject to spatial and temporal regulation. These proteins have a modular structure which includes a conserved motor domain of approximately 350 amino acids, which is responsible for microtubule binding and ATP hydrolysis. In addition to the motor domain, subfamily members share common domain organization, exhibit sequence similarity, motility properties, and cellular functions outside of the motor domain. An expansive phylogenetic tree of kinesins and kinesin-related proteins (KRPs) has been assembled based on this information. Kinesin C2 (KIFC2) is a C-type kinesin based on the position of the motor domain towards the carboxyl-terminus of the protein and is similar to members of the karyogamy protein 3 (KAR3) family involved in cell division. KIFC2 protein expression has been demonstrated in axons and dendrites of the central and peripheral nervous system. Unlike other C-type motor proteins, KIFC2 appears to play a role in retrograde axonal transport.

Specifications

• Accession Number: Q96AC6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 90990
• Name: Human KIFC2 (aa 200-296) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: KIFC2; kinesin family member C2; kinesin-like protein KIFC2
• Common Name: KIFC2
• Gene Symbol: Kifc2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QLILGQLEELKQQLEQQEEELGRLRLGVGATDSEKRVQHLTLENEALKQSLSLMRDLLLHWGPGPPIRAPQEEAEALLELQGRLQEAQDTTEALRAQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining