Invitrogen™ Human KIP2 (aa 22-93) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP95125	100 μL

Catalog No. RP95125 Supplier Invitrogen™ Supplier No. RP95125

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57776. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DNA-dependent protein kinases (DNA-PK) play a role in the repair of double-strand DNA breaks and in the process of V(D)J recombination during lymphoid development. By EST database searching for sequences homologous to the DNA-PK gene KIP/CIB and 5-prime RACE, Seki, N et al. isolated a full-length cDNA, which they designated as KIP2, from a human fetal brain cDNA library. KIP2 encodes a deduced 187-amino acid protein with a predicted molecular mass of 22 kD. The KIP2 protein shares 46%, 39%, and 30% sequence identity with the calcium-binding proteins KIP/CIB, calcineurin B and calmodulin respectively. KIP2 contains two EF-hand motifs and a helix-loop-helix motif involved in coordinating the calcium ion, indicating that KIP2 may also bind calcium. KIP2 is ubiquitously expressed in various human tissues.

Specifications

• Accession Number: O75838
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 10518
• Name: Human KIP2 (aa 22-93) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2810434I23Rik; AI449053; calcium and integrin binding family member 2; calcium and integrin-binding family member 2; calcium binding protein Kip 2; calcium binding protein Kip2; CIB2; DFNB48; DNA-dependent protein kinase catalytic subunit-interacting protein 2; kinase interacting protein 2; kinase-interacting protein 2; KIP 2; Kip2; USH1J
• Common Name: KIP2
• Gene Symbol: CIB2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining