Invitrogen™ Human Kir1.1 (KCNJ1) (aa 303-387) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90994	100 μL

Catalog No. RP90994 Supplier Invitrogen™ Supplier No. RP90994

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82946. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. It is activated by internal ATP and probably plays an important role in potassium homeostasis. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Mutations in this gene have been associated with antenatal Bartter syndrome, which is characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: P48048
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3758
• Name: Human Kir1.1 (KCNJ1) (aa 303-387) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ATP-regulated potassium channel ROM-K; ATP-sensitive inward rectifier potassium channel 1; inward rectifier K(+) channel Kir1.1; inwardly rectifying K+ channel; inwardly rectifying potassium channel ROMK-2; K+ channel protein; KAB-1; Kcnj; Kcnj1; KIR1.1; LOW QUALITY PROTEIN: ATP-sensitive inward rectifier potassium channel 1; OTTHUMP00000045938; potassium channel, inwardly rectifying subfamily J member 1; potassium channel, inwardly rectifying subfamily J, member 1; potassium inwardly rectifying channel subfamily J member 1; potassium inwardly-rectifying channel J1; Potassium inwardly-rectifying channel subfamily J; potassium inwardly-rectifying channel, subfamily J, member 1; potassium voltage-gated channel subfamily J member 1; ROMK; ROMK1; Romk2
• Common Name: Kir1.1 (KCNJ1)
• Gene Symbol: KCNJ1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining