Invitrogen™ Human Kir2.1 (KCNJ2) (aa 348-397) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90945	100 μL

Catalog No. RP90945 Supplier Invitrogen™ Supplier No. RP90945

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56059. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The KIR2 subunit family includes 2. 1, 2. 2, 2. 3 and 2. 4. Unlike G protein-coupled KIR3 subunits, KIR2. 1 requires both phosphorylation by PKA and ATP hydrolysis for functional activity. KIR2. 1 is expressed in the superior and inferior collicula and the pontine region of the brain, where it moderates synaptic transmission, like many other potassium channels. In the placenta, KIR2. 1 is expressed throughout gestation in cytotrophoblast cells. In the kidney, KIR2. 1 colocalizes with KIR5. 1 in the proximal tubule. KIR2. 1, 2. 2 and 2. 3 associate with the membrane-associated guanylate kinase synapseassociated protein 97 in the cerebellum and heart. Phosphorylation of KIR2. 2 by protein kinase A inhibits the associates with SAP97.

Specifications

• Accession Number: P63252
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3759
• Name: Human Kir2.1 (KCNJ2) (aa 348-397) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ATFB9; cardiac inward rectifier KIR2.1; cardiac inward rectifier potassium channel; EGK_08925; HHBIRK1; HHIRK 1; HHIRK1; HIRK 1; hIRK1; Inward rectifier K; inward rectifier K(+) channel Kir2.1; inward rectifier K+ channel KIR2.1; inward rectifier potassium channel; inward rectifier potassium channel 2; inwardly rectifying potassium channel Kir2.1; IRK 1; IRK1; IRK-1; IRK2; Kcnf1; KCNJ2; KIR2.1; LQT 7; LQT7; Potassium channel, inwardly rectifying subfamily J member 2; potassium channel, inwardly rectifying subfamily J, member 2; potassium inwardly rectifying channel subfamily J member 2; potassium inwardly-rectifying channel, subfamily J, member 2; potassium voltage-gated channel subfamily J member 2; RBL-IRK1; SQT 3; SQT3
• Common Name: Kir2.1 (KCNJ2)
• Gene Symbol: Kcnj2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YEVPNTPLCSARDLAEKKYILSNANSFCYENEVALTSKEEDDSENGVPES
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining