Invitrogen™ Human Kir4.1 (KCNJ10) (aa 310-379) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108298	100 μL

Catalog No. RP108298 Supplier Invitrogen™ Supplier No. RP108298

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85057. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The KIR (for inwardly rectifying potassium channel) family of potassium channels possess a greater tendency to allow potassium to flow into the cell rather than out of it. KIR4.1, also known as Kir1.2, is highly expressed in brain including glial cells, astrocytes and cortical neurons. KIR4.1 is also expressed in myelin-synthesizing oligodendrocytes and is crucial to myelination in the developing nervous system. The gene encoding human KIR4.1 maps to chromosome 1. KIR4.2, also known as Kir1.3, is expressed in kidney, lung, heart, thymus and thyroid during development. The gene encoding human KIR4.2 maps to chromosome 21 in the Down syndrome chromosome region 1, and KIR4.2 may play a role in the pathogenesis of Downs syndrome. KIR5.1 forms functional channels only by coexpression with either KIR4.1 or KIR4.2 in the kidney and pancreas.

Specifications

• Accession Number: P78508
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3766
• Name: Human Kir4.1 (KCNJ10) (aa 310-379) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ATP-dependent inwardly rectifying potassium channel Kir4.1; ATP-sensitive inward rectifier potassium channel 10; ATP-sensitive inward rectifier potassium channel KAB-2; BIR10; BIRK1; BIRK-1; BIRK10; BIRK-10; brain-specific inwardly rectifying K(+) channel 1; glial ATP-dependent inwardly rectifying potassium channel KIR4.1; inward rectifier K(+) channel Kir1.2; Inward rectifier K(+) channel Kir4.1; inward rectifier K+ channel KIR1.2; Kab-2; Kcnj10; KCNJ13 PEN; KCNJ13-PEN; Kir1.2; Kir4.1; potassium channel, inwardly rectifying subfamily J member 10; potassium channel, inwardly rectifying subfamily J, member 10; potassium inwardly-rectifying channel, subfamily J, member 10; potassium voltage-gated channel subfamily J member 10; SESAME
• Common Name: Kir4.1 (KCNJ10)
• Gene Symbol: KCNJ10
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining