Invitrogen™ Human Kir6.2 (KCNJ11) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100884	100 μL

Catalog No. RP100884 Supplier Invitrogen™ Supplier No. RP100884

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111283. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This receptor is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium. Subunit of ATP-sensitive potassium channels (KATP). Can form cardiac and smooth muscle-type KATP channels with ABCC9. KCNJ11 forms the channel pore while ABCC9 is required for activation and regulation.

Specifications

• Accession Number: Q14654
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3767
• Name: Human Kir6.2 (KCNJ11) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI842722; ATP-sensitive inward rectifier potassium channel 11; AW491124; beta-cell inward rectifier subunit; BIR; HHF2; IKATP; Inward rectifier K(+) channel Kir6.2; inwardly rectifying potassium channel KIR6.2; IRK11; KATP; KATP channel; KCNJ11; Kir6.2; mBIR; MGC133230; MODY13; PHHI; potassium channel inwardly rectifing subfamily J member 11; potassium channel, inwardly rectifying subfamily J member 11; potassium channel, inwardly rectifying subfamily J, member 11; potassium inwardly rectifying channel, subfamily J, member 11; potassium inwardly-rectifying channel subfamily J member 11; potassium inwardly-rectifying channel, subfamily J, member 11; potassium voltage-gated channel subfamily J member 11; TNDM3
• Common Name: Kir6.2 (KCNJ11)
• Gene Symbol: Kcnj11
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining