Invitrogen™ Human KLF3 (aa 2-64) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP107399	100 μL

Catalog No. RP107399 Supplier Invitrogen™ Supplier No. RP107399

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66743. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Krueppel-like factors (KLFs) comprise a family of evolutionarily conserved zinc finger-containing transcription factors with diverse regulatory functions in cell growth, proliferation, differentiation and embryogenesis. Individual members of the Sp1-like/KLF family can function either as activators or repressors, depending on which promoter they bind and the coregulators with which they interact. KLF6, also designated Zf9 or CPBP (core promoter-binding protein), and KLF3 are Kruppel-like zinc finger containing transcription factors. KLF6 is rapidly induced during hepatic stellate cell activation and transactivates a reporter gene driven by the collagen I promoter, suggesting KLF6 plays a role in the response to tissue injury. KLF3 may play a role in hematopoiesis.

Specifications

• Accession Number: P57682
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 51274
• Name: Human KLF3 (aa 2-64) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 9930027G08Rik; AL024007; Basic krueppel-like factor; basic kruppel like factor; Basic Kruppel- like factor; basic Kruppel-like factor; BKLF; CACCC-box-binding protein BKLF; klf12; Klf3; Krueppel-like factor 3; kruppel like factor 12; Kruppel like factor 3; Kruppel-like factor 12; Kruppel-like factor 3 (basic); MGC48279; TEF-2; transcript ch138; zinc finger containing transcription factor
• Common Name: KLF3
• Gene Symbol: Klf3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQMEPVDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining