Invitrogen™ Human Krt222 (aa 1-74) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100329	100 μL

Catalog No. RP100329 Supplier Invitrogen™ Supplier No. RP100329

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60477. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KRT222, also known as KRT222P. KRT222 is a 295 amino acid protein belonging to the intermediate filament family. The gene encoding KRT222P has been listed as a pseudogene, however it has not been established that the protein is not translated, and is therefore treated as a protein coding gene. Existing as two alternatively spliced isoforms, the gene encoding KRT222P maps to human chromosome 17, which comprises over 2.5% of the human genome and encodes over 1,200 genes. Two key tumor suppressor genes are associated with chromosome 17, namely, p53 and BRCA1. Tumor suppressor p53 is necessary for maintenance of cellular genetic integrity by moderating cell fate through DNA repair versus cell death. Malfunction or loss of p53 expression is associated with malignant cell growth and Li-Fraumeni syndrome. Like p53, BRCA1 is directly involved in DNA repair, though specifically it is recognized as a genetic determinant of early onset breast cancer and predisposition to cancers of the ovary, colon, prostate gland and fallopian tubes.

Specifications

• Accession Number: Q8N1A0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 125113
• Name: Human Krt222 (aa 1-74) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 6330509G02Rik; KA21; keratin 222; keratin 222 pseudogene; keratin 222, type II; keratin-222; Keratin-222 pseudogene; keratin-like protein KRT222; Krt222; KRT222P
• Common Name: Krt222
• Gene Symbol: Krt222
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAAQAELKEARRQWHHLQVEIESLHA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining