Invitrogen™ Human Ku70 (aa 407-506) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103007	100 μL

Catalog No. RP103007 Supplier Invitrogen™ Supplier No. RP103007

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83871. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

XRCC6 is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.

Specifications

• Accession Number: P12956
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 2547
• Name: Human Ku70 (aa 407-506) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5'-deoxyribose-5-phosphate lyase Ku70; 5'-dRP lyase Ku70; 5'-dRP/AP lyase Ku70; 70 kDa subunit of Ku antigen; 70kDa; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; ATP-dependent DNA helicase II, 70 kDa subunit; CT; CTA-216E10.7; CTC box binding factor 75 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; CTCBF; DNA repair protein XRCC6; G22p1; Ku autoantigen p70 subunit; ku autoantigen protein p70 homolog; Ku autoantigen, 70kDa; Ku p70; Ku70; Ku70 DNA-binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa); Kup70; Lupus Ku autoantigen protein p70; ML8; OTTHUMP00000028581; thyroid autoantigen; thyroid autoantigen 70 kDa; thyroid autoantigen 70kD (Ku antigen); thyroid autoantigen 70kDa (Ku antigen); Thyroid-lupus autoantigen; thyroid-lupus autoantigen p70; TLAA; XELAEV_18023498mg; X-ray repair complementing defective repair in Chinese hamster cells 6; X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog; X-ray repair cross complementing 6; X-ray repair cross-complementing protein 6; xrcc6; xrcc6.L
• Common Name: Ku70
• Gene Symbol: XRCC6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining