Invitrogen™ Human KV1.4 (KCNA4) (aa 562-653) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91125	100 μL

Catalog No. RP91125 Supplier Invitrogen™ Supplier No. RP91125

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53416. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, is a protein that in humans is encoded by the KCNA4 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. It is mapped to 11p14.1. KCNA4 belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influence the duration of cardiac action potential. KCNA4 also contributes to the cardiac transient outward potassium current (Ito1), the main contributing current to the repolarizing phase 1 of the cardiac action potential. This gene has been shown to interact with DLG4, KCNA2 and DLG1.

Specifications

• Accession Number: P22459
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3739
• Name: Human KV1.4 (KCNA4) (aa 562-653) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: cardiac potassium channel; fetal skeletal muscle potassium channel; HBK4; HK1; HPCN2; HUKII; KCHAN; Kcna4; KCNA4L; KCNA8; Kv1.4; Kv4; PCN2; potassium channel 2; potassium channel, voltage gated shaker related subfamily A, member 4; potassium voltage gated channel, shaker related subfamily, member 4; potassium voltage-gated channel subfamily A member 4; potassium voltage-gated channel, shaker-related subfamily, member 4; rapidly inactivating potassium channel; RCK4; RHK1; RK3; shaker-related potassium channel Kv1.4; type A potassium channel; voltage-gated K(+) channel HuKII; Voltage-gated potassium channel HBK4; voltage-gated potassium channel HK1; Voltage-gated potassium channel subunit Kv1.4
• Common Name: KV1.4 (KCNA4)
• Gene Symbol: KCNA4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining