Invitrogen™ Human KV1.6 (KCNA6) (aa 473-522) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP110023	100 μL

Catalog No. RP110023 Supplier Invitrogen™ Supplier No. RP110023

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145136. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class. The coding region of this gene is intronless, and the gene is clustered with genes KCNA1 and KCNA5 on chromosome 12.

Specifications

• Accession Number: P17658
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3742
• Name: Human KV1.6 (KCNA6) (aa 473-522) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: FLJ25134; HBK2; human brain potassium channel-2; KCNA6; KV1.6; kv2; MK1.6; potassium channel, voltage gated shaker related subfamily A, member 6; potassium channel-Kv2; potassium voltage gated channel, shaker related subfamily, member 6; potassium voltage gated channel, shaker related, subfamily, member 6; potassium voltage-gated channel subfamily A member 6; potassium voltage-gated channel, shaker-related subfamily, member 6; potassium voltage-gated channel, shaker-related, subfamily, member 6; PPP1R96; protein phosphatase 1, regulatory subunit 96; RCK2; voltage-gated potassium channel HBK2; voltage-gated potassium channel protein Kv1.6; voltage-gated potassium channel subunit Kv1.6; voltage-gated potassium channel subunit Kv2
• Common Name: KV1.6 (KCNA6)
• Gene Symbol: KCNA6
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EQGQYTHVTCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining