Invitrogen™ Human KV4.3 (KCND3) (aa 527-653) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP91276	100 μL

Catalog No. RP91276 Supplier Invitrogen™ Supplier No. RP91276

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56151. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This member includes two isoforms with different sizes, which are encoded by alternatively spliced transcript variants of this gene.

Specifications

• Accession Number: Q9UK17
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3752
• Name: Human KV4.3 (KCND3) (aa 527-653) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AW045978; BRGDA9; KCND3; KCND3L; KCND3S; Kncd3; KSHIVB; KV4.3; potassium channel alpha subunit Kv4.3 short form; potassium channel Kv4.3; potassium channel Kv4.3L; potassium channel Kv4.3M; potassium channel, voltage gated Shal related subfamily D, member 3; potassium channel, voltage-gated Shal-related subfamily D, member 3; potassium ionic channel Kv4.3; potassium voltage gated channel, Shal-related family, member 3; potassium voltage-gated channel long; potassium voltage-gated channel subfamily D member 3; potassium voltage-gated channel, Shal-related family, member 3; potassium voltage-gated channel, Shal-related subfamily, member 3; SCA19; SCA22; sha1-related potassium channel Kv4.3; voltage-gated K+ channel; voltage-gated potassium channel subunit Kv4.3
• Common Name: KV4.3 (KCND3)
• Gene Symbol: KCND3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining