Invitrogen™ Human L3MBTL1 (aa 746-829) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108536	100 μL

Catalog No. RP108536 Supplier Invitrogen™ Supplier No. RP108536

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-144881, PA5-111629. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

L3MBTL1 is the homolog of a protein identified in Drosophila as a suppressor of malignant transformation of neuroblasts and ganglion-mother cells in the optic centers of the brain. L3MBTL1 is localized to condensed chromosomes in mitotic cells and overexpression of this protein in a glioma cell line results in improper nuclear segregation and cytokinesis producing multinucleated cells. L3MBTL1 represents a polycomb group gene the encoded protein functions to regulate gene activity, likely via chromatin modification. Polycomb group protein specifically recognizes and binds mono- and dimethyllysine residues on target proteins, thereby acting as a reader of a network of post-translational modifications. Alternatively spliced transcript variants encoding different isoforms of the L3MBTL1 gene have been identified.

Specifications

• Accession Number: Q9Y468
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 26013
• Name: Human L3MBTL1 (aa 746-829) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C630004G01; dJ138B7.3; H-l(3)mbt; H-l(3)mbt protein; Kiaa0681; L(3)mbt protein homolog; l(3)mbt-like (Drosophila); l(3)mbt-like 1; l(3)mbt-like 1 (Drosophila); L3mbt; L3MBTL; L3MBTL histone methyl-lysine binding protein 1; L3MBTL1; L3MBTL1, histone methyl-lysine binding protein; lethal (3) malignant brain tumor l(3); lethal(3)malignant brain tumor-like protein 1; lethal(3)malignant brain tumor-like protein 1; serine/threonine-protein kinase Sgk2; LOC100070683; mKIAA0681; RGD1307316; RP1-138B7.1; ZC2HC3
• Common Name: L3MBTL1
• Gene Symbol: L3MBTL1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STVAKWTIDEVFGFVQTLTGCEDQARLFKDEARIVRVTHVSGKTLVWTVAQLGDLVCSDHLQEGKGILETGVHSLLCSLPTHLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining