Invitrogen™ Human LAIR1 (aa 187-287) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90424	100 μL

Catalog No. RP90424 Supplier Invitrogen™ Supplier No. RP90424

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82418. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD305, also known as LAIR1, is a type I transmembrane glycoprotein with an extracellular Ig-like domain and two intracellular ITIMs. It is expressed on a wide range of immune cells, including T, NK, and B cells, monocytes, dendritic cells, eosinophils, basophils, and mast cells. In humans, CD305 is also present on CD34+ hematopoietic progenitor cells and thymocytes. Several isoforms exist due to alternative splicing, with expression varying between cell types. CD305 functions as an inhibitory receptor, playing a key role in regulating immune responses. It blocks cytokine-mediated signaling, cell proliferation, and apoptosis. In NK, B, and T cells, CD305 modulates cytolytic functions and cytokine production, down-regulating IL2 and IFNG in CD4+ T cells while inducing transforming growth factor beta. In B cells, it reduces IgG and IgE production and decreases IL8, IL10, and TNF secretion. Activation of CD305 through tyrosine phosphorylation recruits phosphatases PTPN6 and PTPN11, although it may also function independently of SH2-containing phosphatases. It inhibits differentiation of peripheral blood precursors into dendritic cells and has been shown to induce apoptosis in myeloid leukemia cell lines. Collagens are identified as ligands for CD305, underscoring its role in immune regulation.

Specifications

• Accession Number: Q6GTX8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3903
• Name: Human LAIR1 (aa 187-287) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 5133400O11Rik; BB115266; CD305; D7Bwg0421e; immunoglobulin heavy chain variable region; Lair1; Lair-1; leukocyte associated immunoglobulin like receptor 1; leukocyte-associated Ig-like receptor 1; leukocyte-associated Ig-like receptor-1; leukocyte-associated immunoglobulin-like receptor 1; rLAIR1
• Common Name: LAIR1 (CD305)
• Gene Symbol: LAIR1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining