Invitrogen™ Human Lamin B1 (aa 410-491) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP103972	100 μL

Catalog No. RP103972 Supplier Invitrogen™ Supplier No. RP103972

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lamin B1 is a key member of the nuclear lamina structure, encoded by the LMNB1 gene. It is part of the B-type lamins, ubiquitously expressed across all mammalian cells, providing structural integrity and mechanical support by forming a meshwork along the inner nuclear membrane. Lamin B1 is involved in maintaining the shape and stability of the nucleus, playing a critical role in cellular processes such as genome organization, DNA replication, and transcription regulation. The lamin filaments are type V intermediate filament proteins, enabling the nucleus to withstand mechanical stress and preserve its functionality. Lamin B1's expression and dynamics vary during cell differentiation, influencing gene regulation. Its location within the euchromatin-enriched section of the genome suggests potential roles in chromatin organization and the epithelial-to-mesenchymal transition. Governed by complex interactions with other proteins, lamin B1 is integral to cellular architecture and health, with variations in its levels linked to developmental and disease processes. Recent studies have highlighted the importance of understanding the role and dynamics of lamin B1 in human-induced pluripotent stem cells and germ layer cells, offering insights into differentiation-dependent changes and their implications for nuclear structure.

Specifications

• Accession Number: P20700
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4001
• Name: Human Lamin B1 (aa 410-491) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 0710005A05Rik; ADLD; C-flanking peptide of NPY; CPON; fc06g01; I79_003938; lamin B1; lamin B1 L homeolog; lamin B1 protein; lamin-b; lamin-B1; Lamin-L(I); LMN; LMN2; LMNB; LMNB1; lmnb1 protein; lmnb1.L; MGC111419; Neuropeptide tyrosine; Neuropeptide Y; NPY; NPY02; prepro-neuropeptide Y; pro-neuropeptide Y; PYY4; RATNPY; RATNPY02; unnamed protein product; wu:fc06g01; XELAEV_18007951mg
• Common Name: Lamin B1
• Gene Symbol: Lmnb1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining