Invitrogen™ Human Laminin beta-3 (aa 1027-1156) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89620	100 μL

Catalog No. RP89620 Supplier Invitrogen™ Supplier No. RP89620

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene.

Specifications

• Accession Number: Q13751
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3914
• Name: Human Laminin beta-3 (aa 1027-1156) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI1A; BM600-125KDA; Epiligrin subunit bata; kalinin B1 chain; Kalinin subunit beta; kalinin-140kDa; LAM5; Lamb3; Laminin B1k chain; laminin beta 3; laminin chain; laminin S B3 chain; laminin subunit beta 3; laminin subunit beta-3; laminin, beta 3; laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD)); laminin-5 subunit beta; LAMNB1; Nicein subunit beta; nicein, 125kD; nicein, 125kDa; nicein-125k; nicein-125kDa; RP1-272L16.3
• Common Name: Laminin beta-3
• Gene Symbol: LAMB3
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQQLAEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining