Invitrogen™ Human Laminin gamma-1 (aa 1442-1552) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101884	100 μL

Catalog No. RP101884 Supplier Invitrogen™ Supplier No. RP101884

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81992. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Laminins are essential and abundant structural non-collagenous glycoproteins localizing to basement membranes. Basement membranes (cell-associated extracellular matrices (ECMs)) are polymers of Laminins with stabilizing Type IV Collagen networks, Nidogen and several proteoglycans. Basement membranes are found under epithelial layers, around the endothelium of blood vessels, and surrounding muscle, peripheral nerve and fat cells. Formation of basement membranes influences cell proliferation, phenotype, migration, gene expression and tissue architecture. Each Laminin is a heterotrimer of alpha, beta and gamma chain subunits that undergoes cell-secretion and incorporation into the ECM. Laminins can self-assemble, bind to other matrix macromolecules and have unique and shared cell interactions mediated by Integrins, dystroglycan and cognate Laminin receptors. The human Laminin gamma-1 gene maps to chromosome 1q31 and is ubiquitously expressed in tissues that produce basement membranes.

Specifications

• Accession Number: P11047
• Concentration: 2.1 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3915
• Name: Human Laminin gamma-1 (aa 1442-1552) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AA408497; B2e; basement membrane protein; LAMA; LAMA1; Lama-1; LAMB2; LAMC1; Laminin A chain; laminin B2 chain; laminin gamma 1 chain; laminin S; laminin subunit alpha 1; laminin subunit alpha-1; laminin subunit gamma 1; laminin subunit gamma-1; laminin, alpha 1; laminin, beta 2; laminin, gamma 1; laminin, gamma 1 (formerly LAMB2); laminin-1; laminin-1 subunit alpha; Laminin-1 subunit gamma; laminin-10 subunit gamma; Laminin-11 subunit gamma; laminin-2 subunit gamma; Laminin-3 subunit alpha; laminin-3 subunit gamma; Laminin-4 subunit gamma; laminin-6 subunit gamma; Laminin-7 subunit gamma; laminin-8 subunit gamma; Laminin-9 subunit gamma; PTBHS; S-LAM alpha; S-LAM gamma; S-LAM-alpha; S-laminin subunit alpha; S-laminin subunit gamma
• Common Name: Laminin gamma-1
• Gene Symbol: LAMC1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining