Invitrogen™ Human LAMP2 (aa 325-375) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP108788	100 μL

Catalog No. RP108788 Supplier Invitrogen™ Supplier No. RP108788

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LAMP2 (Lysosome-associated membrane glycoprotein 2, CD107b) is a member of a family of membrane glycoproteins. LAMP2 provides selectins with carbohydrate ligands, and may play a role in tumor cell metastasis, and have a function in the protection, maintenance, and adhesion of the lysosome. Prior to posttranslational modification, LAMP2 is approximately 46 kDa polypeptide. Mature, functional LAMP2 is extensively glycosylated with a variety of different N-linked and O-linked oligosaccharides with a total molecular weight of about 100-130 kDa. LAMP 2 has a structure comprised of a large amino-terminal intra-lysosomal domain, a hydrophobic trans-membrane domain, and a short carboxyl-terminal cytoplasmic tail. LAMP2 is used to monitor a very selective form of autophagy called chaperone-mediated autophagy. LAMP 2 has a structure comprised of a large amino-terminal intra-lysosomal domain, a hydrophobic trans-membrane domain, and a short carboxyl-terminal cytoplasmic tail. The LAMP protein has 3 variant forms: LAMP-2A, -2B, and 2C. LAMP2, together with CD107a/LAMP-1, is a major constituent of lysosomal membrane. The LAMP proteins are involved in lysosome biogenesis and are required for fusion of lysosomes with phagosomes, and LAMP2 is an important regulator in successful phagosomal maturation. LAMP2 deficiency causes an accumulation of autophagosomes in many tissues leading to cardiomyopathy and myopathy (Danon's disease).

Specifications

• Accession Number: P13473
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3920
• Name: Human LAMP2 (aa 325-375) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: CD107 antigen-like family member B; CD107b; EGK_20887; Igp96; Lamp II; LAMP2; LAMP-2; LAMP-2 Isoform 2A; LAMP-2 Variant A; Lamp-2a; Lamp-2b; Lamp-2c; LAMPB; LGP110; LGP-110; LGP-96; LGP-B; lysosomal associated membrane protein 2; lysosomal membrane glycoprotein 2; lysosomal membrane glycoprotein type B; lysosomal-associated membrane protein 2; lysosome-associated membrane glycoprotein 2; lysosome-associated membrane protein 2; Mac3; RP23-193O17.2
• Common Name: LAMP2 (CD107b)
• Gene Symbol: LAMP2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining