Invitrogen™ Human Lano (aa 448-522) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94870	100 μL

Catalog No. RP94870 Supplier Invitrogen™ Supplier No. RP94870

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56792. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lano is a member of the LAP (leucine-rich repeats and PDZ) family of proteins that also includes Densin-180, Erbin, and hScribble. The LAP proteins generally contain multiple leucine-rich repeat (LRR) domains which serve to target them to the basolateral membrane of epithelial cells. Lano is unique in that it alone does not possess one or more PDZ (PSD95/DLG/ZO-1) domains as do the other members of the LAP family. However, it can bind to the PDZ domain of Erbin in addition to those of membrane-associated and guanylate kinase (MAGUK) proteins which regulate adhesion and plasticity at cell junctions. It has been suggested that it is through these interaction that these LAP proteins participate in the maintenance of proper embryonic development and integrity of epithelial tissues.

Specifications

• Accession Number: Q9BTT6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55227
• Name: Human Lano (aa 448-522) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A430093J20Rik; AU016091; D030059I21; dJ523E19.1; LANO; LANO adapter protein; LAP (leucine-rich repeats and PDZ) and no PDZ protein; LAP and no PDZ protein; leucine rich repeat containing 1; leucine-rich repeat-containing 1; leucine-rich repeat-containing protein 1; LRRC1; mKIAA4018; RP3-523E19.1
• Common Name: Lano
• Gene Symbol: LRRC1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NERAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMKKTVENLRNDMNAAKGLDSNKNEVNHAIDRVTT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining