Invitrogen™ Human LCN15 Control Fragment Recombinant Protein

Catalog No.	Quantity
RP101526	100 μL

Catalog No. RP101526 Supplier Invitrogen™ Supplier No. RP101526

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (34%), Rat (34%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63882. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The LCN15 (Lipocalin 15) gene encodes a protein that belongs to the lipocalin family, a group of small extracellular proteins characterized by their ability to bind and transport small hydrophobic molecules. LCN15 is a human-specific protein found abundantly in the olfactory mucus. It has been identified as a biomarker for Bowman gland cells in the olfactory neuroepithelium, with its expression correlating with non-degenerated areas of this tissue. The lipocalin family proteins, including LCN15, exhibit significant sequence heterogeneity but possess highly conserved tertiary structures with an eight-stranded antiparallel β-barrel. This structure forms a binding pocket that allows them to transport a wide variety of molecules, including retinol, steroids, and various lipids.

Specifications

• Accession Number: Q6UWW0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 389812
• Name: Human LCN15 Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: LCN15; lipocalin 15; lipocalin-15; MSFL2541; PRO6093; UNQ2541; UNQ2541/PRO6093
• Common Name: LCN15
• Gene Symbol: LCN15
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FAVLYIYKELEGALSTMVQLYSRTQDVSPQALKAFQDFYPTLGLPEDMMVMLPQSDACNPESKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining