Invitrogen™ Human LEMD2 (aa 243-361) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP89512	100 μL

Catalog No. RP89512 Supplier Invitrogen™ Supplier No. RP89512

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53589. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The LEM (lamina-associated polypeptide-emerin-MAN1) domain is a motif shared by a group of lamin-interacting proteins of the inner nuclear membrane (INM) and nucleoplasm. One such protein, LEMD2 (LEM domain-containing protein 2), is a lamina-associated protein in the INM involved in nuclear structure organization, containing an N-terminal LEM motif, two transmembrane domains, and a MAN1-Src1p C-terminal (MSC) domain. LEMD2 is a truncated paralog of MAN1, lacking the MAN1-specific C-terminal RNA-recognition motif, but like MAN1 is required for myogenic differentiation. Mutations in LEMD2 are thought be among the possible causes of muscle disease.

Specifications

• Accession Number: Q8NC56
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 221496
• Name: Human LEMD2 (aa 243-361) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: BC026588; CTRCT42; dJ482C21.1; hLEM2; LEM domain containing 2; LEM domain-containing protein 2; Lem2; LEMD2; NET25; nuclear envelope constituent; Nuclear envelope transmembrane protein 25
• Common Name: LEMD2
• Gene Symbol: LEMD2
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAHP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining