Invitrogen™ Human LGR7 (aa 687-755) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90883	100 μL

Catalog No. RP90883 Supplier Invitrogen™ Supplier No. RP90883

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LGR7 is a low density lipoprotein receptor of 757amino acid belonging to the G-protein coupled receptor 1 family with rhodopsin-like receptor activity. It has seven transmembrane region, cysteine-rich motif, 10 LRR domains and 5 N-glycosylation sites in the N terminus. Research reports show that it has receptor for relaxins (RLN1 and RLN2) which stimulates adenylate cyclase activation, substrate adhesion, and chemo migratory capacity of mononuclear leukocytes. LGR7 is critical for mediating these biological responses by use of RNA interference lentiviral short hairpin constructs. It is widely expressed in 86% of 15 primary EC tissue samples including brain, kidney, testis and endometrium.

Specifications

• Accession Number: Q9HBX9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 59350
• Name: Human LGR7 (aa 687-755) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: Gm1018; leucine-rich repeat-containing 7; leucine-rich repeat-containing G protein-coupled receptor 7; leucine-rich repeat-containing G-protein coupled receptor 7; LGR7; LGR7.1; LGR7.10; LGR7.2; MGC138347; MGC142177; Relaxin family peptide receptor 1; relaxin receptor 1; relaxin/insulin like family peptide receptor 1; relaxin/insulin-like family peptide receptor 1; RXFP1; RXFPR1
• Common Name: LGR7
• Gene Symbol: RXFP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining