Invitrogen™ Human LIAR (aa 13-78) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP104200	100 μL

Catalog No. RP104200 Supplier Invitrogen™ Supplier No. RP104200

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64457. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ankyrin (ANK) repeats mediate protein-protein interactions in diverse families of proteins. The number of ANK repeats in a protein can range from 2 to over 20. ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two anti-parallel helices and a beta-hairpin, with repeats stacked in a superhelical arrangement. LIAR, also known as ANKRD54, is a recently identified ANK repeat-containing protein that is predominantly expressed in tissues rich in ciliated cells, such as olfactory sensory neurons and is predicted to be important to cilia. At least three isoforms of LIAR are known to exist.

Specifications

• Accession Number: Q6NXT1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 129138
• Name: Human LIAR (aa 13-78) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: ANKRD54; ankyrin repeat domain 54; ankyrin repeat domain-containing protein 54; C730048E16Rik; EST1068184; EST475269; LIAR; Lyn-interacting ankyrin repeat protein; RGD1309552
• Common Name: LIAR
• Gene Symbol: ANKRD54
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHVLWQQDAEP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining