Invitrogen™ Human LIMS1 (aa 1-42) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP105173	100 μL

Catalog No. RP105173 Supplier Invitrogen™ Supplier No. RP105173

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84484. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is an adaptor protein which contains five LIM domains, or double zinc fingers. The protein is likely involved in integrin signaling through its LIM domain-mediated interaction with integrin-linked kinase, found in focal adhesion plaques. It is also thought to act as a bridge linking integrin-linked kinase to NCK adaptor protein 2, which is involved in growth factor receptor kinase signaling pathways. Its localization to the periphery of spreading cells also suggests that this protein may play a role in integrin-mediated cell adhesion or spreading. Several transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: P48059
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 3987
• Name: Human LIMS1 (aa 1-42) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2310016J22Rik; 4921524A02Rik; AI507642; AU021743; AW551584; C430041B13Rik; LIM and senescent cell antigen-like domains 1; LIM and senescent cell antigen-like-containing domain protein 1; LIM zinc finger domain containing 1; LIMS1; Lims1l; LIM-type zinc finger domains 1; Particularly interesting new Cys-His protein 1; PINCH; PINCH1; PINCH-1; renal carcinoma antigen NY-REN-48; RGD1560732; senescent cell antigen
• Common Name: LIMS1
• Gene Symbol: LIMS1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELSNMANAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining