Invitrogen™ Human LNPEP (aa 710-842) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90122	100 μL

Catalog No. RP90122 Supplier Invitrogen™ Supplier No. RP90122

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83672. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a zinc-dependent aminopeptidase that cleaves vasopressin, oxytocin, lys-bradykinin, met-enkephalin, dynorphin A and other peptide hormones. The protein can be secreted in maternal serum, reside in intracellular vesicles with the insulin-responsive glucose transporter GLUT4, or form a type II integral membrane glycoprotein. The protein catalyzes the final step in the conversion of angiotensinogen to angiotensin IV (AT4) and is also a receptor for AT4. Alternative splicing results in multiple transcript variants encoding different isoforms.

Specifications

• Accession Number: Q9UIQ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4012
• Name: Human LNPEP (aa 710-842) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2010309L07Rik; 4732490P18Rik; aminopeptidase Vp165; angiotensin IV receptor; AT (4) receptor; CAP; Cystinyl aminopeptidase; GP160; insulin-regulated aminopeptidase; insulin-regulated membrane aminopeptidase; insulin-regulated membrane aminopeptidase IRAP; insulin-responsive aminopeptidase; IRAP; leucyl and cystinyl aminopeptidase; leucyl/cystinyl aminopeptidase; leucyl-cystinyl aminopeptidase; Leucyl-cystinyl aminopeptidase, pregnancy serum form; LNPEP; OTase; oxytocinase; Placental leucine aminopeptidase; PLAP; P-LAP; vasopressinase; vesicle protein of 165 kDa; vp160; vp165
• Common Name: LNPEP
• Gene Symbol: LNPEP
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining