Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human LPAR4 (aa 320-365) Control Fragment Recombinant Protein

Catalog No. RP95311
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95311 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95311 Supplier Invitrogen™ Supplier No. RP95311
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EDG4 belongs to a family of G-protein coupled receptors whose ligands are lysophospholipids. There are eight known members of the EDG receptor family and they are implicated in mediating growth-related effects such as induction of cellular proliferation, alterations in differentiation and survival, and suppression of apoptosis. They also evoke cellular effector functions that are dependent on cytoskeletal responses such as contraction, secretion, adhesion and chemotaxis. EDG receptors are developmentally regulated and differ in tissue distribution. They couple to multiple types of G proteins to signal through ras and MAP kinase, rho, phospholipase C, and several protein tyrosine kinases. EDG4 is expressed in testes, ovarian tumor, and leukocyte containing tissues.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99677
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 2846
Name Human LPAR4 (aa 320-365) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 5730485F04Rik; G protein-coupled receptor 23; Gpr23; G-protein coupled receptor 23; LPA receptor 4; LPA4; LPA-4; LPA4 Receptor; Lpar4; Lysophosphatidic acid receptor 4; P2RY9; P2Y purinoceptor 9; P2Y5-LIKE; P2Y5-like receptor; p2y9; Purinergic receptor 9; RGD1563686
Common Name LPAR4
Gene Symbol Lpar4
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.