Invitrogen™ Human LRCH4 (aa 323-395) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP96543	100 μL

Catalog No. RP96543 Supplier Invitrogen™ Supplier No. RP96543

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58050. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LRCH4 is a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that this protein resembles a receptor.This gene encodes a protein that contains leucine-rich repeats (LRR) at its amino terminus and that is known to be involved in ligand binding. The carboxyl terminus may act as a membrane anchor. Identified structural elements suggest that the encoded protein resembles a receptor.

Specifications

• Accession Number: O75427
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4034
• Name: Human LRCH4 (aa 323-395) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 2810008P14Rik; 2900069C24Rik; AI558103; FLJ40101; FLJ46315; leucine rich repeat neuronal 4; leucine rich repeat protein 4, neuronal; leucine rich repeats and calponin homology domain containing 4; leucine-rich neuronal protein; Leucine-rich repeat and calponin homology domain-containing protein 4; Leucine-rich repeat neuronal protein 4; leucine-rich repeats and calponin homology (CH) domain containing 4; Lrch4; LRN; LRRN1; LRRN4; mFLJ00248; PP14183; SAP25
• Common Name: LRCH4
• Gene Symbol: LRCH4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELSFRISELAREPRGPRERKEDGSADGDPVQIDFIDSHVPGEDEERGTVEEQRPPELSPGAGDRERAPSSRRE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining