Invitrogen™ Human LRIG1 (aa 818-942) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90316	100 μL

Catalog No. RP90316 Supplier Invitrogen™ Supplier No. RP90316

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52860. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LRIG1 protein Q96JA1 is coded by a gene on a chromosome band 3p14.3, this region is known to be deleted in various human cancers. LRIG1 is considered to be a tumor suppressor gene in humans. LRIG1 is an integral cell-surface membrane protein that is expressed by specific cells in various human tissues and that its 143-kDa form might be cleaved into 111-kDa and 32-kDa fragments. The LRIG1 protein may inhibit the growth of tumors of glial cells and the down-regulation of the LRIG1 gene may be involved in the development and progression of the tumor.

Specifications

• Accession Number: Q96JA1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 26018
• Name: Human LRIG1 (aa 818-942) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: D6Bwg0781e; DKFZp586O1624; Img; integral membrane glycoprotein; leucine rich repeats and immunoglobulin like domains 1; leucine-rich repeat protein LRIG1; leucine-rich repeats and immunoglobulin like domains 1; leucine-rich repeats and immunoglobulin-like domains 1; leucine-rich repeats and immunoglobulin-like domains protein 1; LIG1; LIG-1; LRIG1; ortholog of mouse integral membrane glycoprotein LIG-1
• Common Name: LRIG1
• Gene Symbol: Lrig1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TRKKSEEYSVTNTDETVVPPDVPSYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPDTHSVACRQPKLCAGSAYHKEPWKAMEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining