Invitrogen™ Human LRP1 (aa 20-168) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP102340	100 μL

Catalog No. RP102340 Supplier Invitrogen™ Supplier No. RP102340

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82802. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD91 is a 600 kDa type I transmembrane protein composed of an alpha and beta chain. The alpha chain interacts with a variety of structurally and functionally diverse ligands, while the beta chain contains two tyrosine phosphorylation motifs that interact with adaptor and signaling proteins. This receptor is expressed by cells in the monocytic lineage, dendritic cells, hepatocytes, fibroblasts, adipocytes, neurons, and syncytiotrophoblasts. CD91 plays a crucial role in several cellular processes, including ligand endocytosis and trafficking to lysosomes, intracellular signaling, lipid homeostasis, and clearance of apoptotic cells. It is involved in cross-presenting antigens via MHC class I molecules on antigen-presenting cells after endocytosis of heat shock protein-peptide complexes. Additionally, CD91 is essential for the A2M-mediated clearance of secreted amyloid precursor protein and beta-amyloid, the main component of amyloid plaques found in Alzheimer patients. Expression of CD91 decreases with age and is found to be lower in brain tissue from Alzheimer patients compared to controls. The receptor also plays a role in cell migration and activating signaling cascades, highlighting its importance in both immune function and disease processes.

Specifications

• Accession Number: Q07954
• Concentration: 4.90 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4035
• Name: Human LRP1 (aa 20-168) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: A2MR; AI316852; alpha 2-macroglobulin receptor; alpha-2-macroglobulin receptor; APOER; Apolipoprotein E receptor; APR; b2b1554Clo; CD91; FLJ16451; IGFBP3R; LDL receptor related protein 1; lipoprotein receptor-related protein; low density lipoprotein receptor-related protein 1; low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor); Low-density lipoprotein receptor-related protein 1 515 kDa subunit; Low-density lipoprotein receptor-related protein 1 85 kDa subunit; Low-density lipoprotein receptor-related protein 1 intracellular domain; Lrp; Lrp1; LRP-1; LRP1A; LRP-515; LRP-85; LRPICD; MGC88725; Prolow-density lipoprotein receptor-related protein 1; TbetaR-V/LRP-1/IGFBP-3 receptor; TGFBR5; type V tgf-beta receptor
• Common Name: LRP1 (CD91)
• Gene Symbol: LRP1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining