Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human LRP1 (aa 4280-4413) Control Fragment Recombinant Protein

Catalog No. RP102330
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102330 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102330 Supplier Invitrogen™ Supplier No. RP102330
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82142. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD91 is a 600 kDa type I transmembrane protein composed of an alpha and beta chain. The alpha chain interacts with a variety of structurally and functionally diverse ligands, while the beta chain contains two tyrosine phosphorylation motifs that interact with adaptor and signaling proteins. This receptor is expressed by cells in the monocytic lineage, dendritic cells, hepatocytes, fibroblasts, adipocytes, neurons, and syncytiotrophoblasts. CD91 plays a crucial role in several cellular processes, including ligand endocytosis and trafficking to lysosomes, intracellular signaling, lipid homeostasis, and clearance of apoptotic cells. It is involved in cross-presenting antigens via MHC class I molecules on antigen-presenting cells after endocytosis of heat shock protein-peptide complexes. Additionally, CD91 is essential for the A2M-mediated clearance of secreted amyloid precursor protein and beta-amyloid, the main component of amyloid plaques found in Alzheimer patients. Expression of CD91 decreases with age and is found to be lower in brain tissue from Alzheimer patients compared to controls. The receptor also plays a role in cell migration and activating signaling cascades, highlighting its importance in both immune function and disease processes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q07954
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 4035
Name Human LRP1 (aa 4280-4413) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias A2MR; AI316852; alpha 2-macroglobulin receptor; alpha-2-macroglobulin receptor; APOER; Apolipoprotein E receptor; APR; b2b1554Clo; CD91; FLJ16451; IGFBP3R; LDL receptor related protein 1; lipoprotein receptor-related protein; low density lipoprotein receptor-related protein 1; low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor); Low-density lipoprotein receptor-related protein 1 515 kDa subunit; Low-density lipoprotein receptor-related protein 1 85 kDa subunit; Low-density lipoprotein receptor-related protein 1 intracellular domain; Lrp; Lrp1; LRP-1; LRP1A; LRP-515; LRP-85; LRPICD; MGC88725; Prolow-density lipoprotein receptor-related protein 1; TbetaR-V/LRP-1/IGFBP-3 receptor; TGFBR5; type V tgf-beta receptor
Common Name LRP1 (CD91)
Gene Symbol LRP1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence STCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGSRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGHCSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.