Invitrogen™ Human LRP12 (aa 564-696) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP90323	100 μL

Catalog No. RP90323 Supplier Invitrogen™ Supplier No. RP90323

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53568. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the LDL receptor gene family, including LDLR (low density lipoprotein receptor), LRP1 (low density lipoprotein related protein), Megalin (also designated GP330), VLDLR (very low density lipoprotein receptor) and ApoER2 are characterized by a cluster of cysteine-rich class A repeats, epidermal growth factor (EGF)-like repeats, YWTD repeats and an O-linked sugar domain. LRP12, also designated ST7, is a member of the LDLR family that is thought to be involved in the internalization of lipophilic molecules and/or signal transduction. LRP12 has been shown to interact with RACK1, MADHIP and Integrin beta-1-binding protein 3. It is widely expressed in heart, skeletal muscle, brain, lung, placenta and pancreas. Overexpression of LRP12 may be associated with oral tumors, therefore implicating LRP12 as a potential oncogene.

Specifications

• Accession Number: Q9Y561
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 29967
• Name: Human LRP12 (aa 564-696) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: AI848829; C820005L12Rik; LDL receptor related protein 12; LDLR-related protein 12; low density lipoprotein receptor-related protein 12; low density lipoprotein-related protein 12; low-density lipoprotein receptor-related protein 12; LRP12; LRP-12; ST7; Suppressor of tumorigenicity 7 protein
• Common Name: LRP12
• Gene Symbol: LRP12
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSSNIWNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENERRDMAGASGGVAAPLPQKVPPTTAVEATVGACASSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining