Invitrogen™ Human LRRC16A Control Fragment Recombinant Protein

Catalog No.	Quantity
RP94632	100 μL

Catalog No. RP94632 Supplier Invitrogen™ Supplier No. RP94632

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56045. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cell membrane-cytoskeleton-associated protein that plays a role in the regulation of actin polymerization at the barbed end of actin filaments. Prevents F-actin heterodimeric capping protein (CP) activity at the leading edges of migrating cells, and hence generates uncapped barbed ends and enhances actin polymerization, however, seems unable to nucleate filaments (PubMed:16054028). Plays a role in lamellipodial protrusion formations and cell migration (PubMed:19846667). [UniProt].

Specifications

• Accession Number: Q5VZK9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 55604
• Name: Human LRRC16A Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 1110037D04Rik; AI425970; capping protein regulator and myosin 1 linker 1; Capping protein regulator and myosin 1 linker protein 1; Capping protein, Arp2/3 and myosin-I linker homolog 1; capping protein, Arp2/3 and myosin-I linker protein 1; capping protein, Arp2/3, and Myosin-I Linker homolog 1; CARMIL; CARMIL homolog; CARMIL1; CARMIL1a; CARML1; D130057M20; dJ501N12.1; dJ501N12.5; F-actin-uncapping protein LRRC16A; leucine rich repeat containing 16; leucine rich repeat containing 16A; leucine-rich repeat-containing protein 16A; Lrrc16; LRRC16A; testicular tissue protein Li 107
• Common Name: LRRC16A
• Gene Symbol: CARMIL1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RSDSKSSPQAGRRYGVQVMGSGLLAEMKAKQEKRAACAQKKLGNDAVSQDSSSPALSSVERSDGGGAVPKLHPGLPENRFGLGTPEKNTKAEPKAEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining