Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human LRRC23 (aa 118-208) Control Fragment Recombinant Protein

Catalog No. RP103301
Encompass_Preferred
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103301 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103301 Supplier Invitrogen™ Supplier No. RP103301
  • $283.00
    $212.25 / Each of 1

    Save $70.75

    25% Off The following deviations and disclosures may produce prices below stated discounts but will not trigger price reductions: Price shown reflects a temporary, promotional price reduction. No other purchase or commercial obligation required to receive the reduced price. Price may change at any time. Promotional price valid on web orders only. Your contract pricing may differ. Other exclusions apply.
Add to Cart
Add to Cart

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63449. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The LRRC23 (Leucine-Rich Repeat Containing 23) gene encodes a protein that is an evolutionarily conserved component of the radial spoke complex in sperm flagella. It is located on human chromosome 12. The LRRC23 protein interacts with radial spoke head proteins such as RSPH3A and RSPH3B, crucial for the structural integrity and proper function of the radial spokes, which are essential for flagellar motility. Mutations or deficiencies in LRRC23 have been linked to male infertility, specifically causing asthenozoospermia, characterized by reduced sperm motility. Studies have identified various mutations in LRRC23 that result in disorganized radial spokes and impaired sperm motility, leading to infertility.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q53EV4
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 10233
Name Human LRRC23 (aa 118-208) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 4921537K05Rik; B7; leucine rich protein, B7; leucine rich repeat containing 23; leucine-rich protein B7; Leucine-rich repeat-containing protein 23; LRPB7; LRRC23; neuron-specific enolase
Common Name LRRC23
Gene Symbol LRRC23
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LKADGNRLRSAQMNELPYLQIASFAYNQITDTEGISHPRLETLNLKGNSIHMVTGLDPEKLISLHTVELRGNQLESTLGINLPKLKNLYLA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.