Invitrogen™ Human LRRC4C (aa 570-633) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP106572	100 μL

Catalog No. RP106572 Supplier Invitrogen™ Supplier No. RP106572

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111400. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Leucine-rich repeat-containing 4C (LRRC4C), also known as Netrin-G ligand 2 (NGL-2), is a gene highlighted for its expression in the nervous system, particularly the brain. It is a member of the leucine-rich repeat superfamily, which plays a significant role in cell adhesion and signaling pathways critical for synaptic connectivity and neuronal development. LRRC4C is involved in neural processes such as axon guidance and synapse formation, aiding in the establishment of functional neural circuits. Additionally, research has suggested that LRRC4C may function as a tumor suppressor, particularly in gliomas, indicating its potential role in neuro-oncological disorders. Variations or deletions in this gene have been linked to neurodevelopmental disorders, demonstrating its importance in normal brain function and development. Furthermore, LRRC4C's expression patterns and associations with cancer also suggest its potential as a prognostic marker in clinical settings.

Specifications

• Accession Number: Q9HCJ2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 57689
• Name: Human LRRC4C (aa 570-633) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: 6430556C10Rik; KIAA1580; leucine rich repeat containing 4C; leucine-rich repeat-containing protein 4C; Lrrc4c; Netrin-G1 ligand; NGL1; NGL-1; RGD1311013; UNQ292/PRO331
• Common Name: LRRC4C
• Gene Symbol: LRRC4C
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining