Invitrogen™ Human LY6G5B (aa 98-192) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP100842	100 μL

Catalog No. RP100842 Supplier Invitrogen™ Supplier No. RP100842

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61705. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction.

Specifications

• Accession Number: Q8NDX9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 58496
• Name: Human LY6G5B (aa 98-192) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C6orf19; G5B; LY6G5B; Lymphocyte antigen 6 complex locus protein G5b; lymphocyte antigen 6 complex, locus G5B; lymphocyte antigen 6 family member G5B; lymphocyte antigen-6 G5B splicing isoform 288; lymphocyte antigen-6 G5B splicing isoform 452; lymphocyte antigen-6 G5B splicing isoform 690; lymphocyte antigen-6 G5B splicing isoform 837
• Common Name: LY6G5B
• Gene Symbol: LY6G5B
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining